SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a013544m|PACid:17691159 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  mgv1a013544m|PACid:17691159
Domain Number - Region: 144-186
Classification Level Classification E-value
Superfamily TSP9-like 0.0471
Family TSP9-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a013544m|PACid:17691159
Sequence length 217
Sequence
MEALGILKFWRNAADGGGDEASFFDLVVKSPDGAAAGRGGGVAKKDLEFIESPTDVFPTK
NSSPVTPLPSATKFKVFILGFRKLSKCEKTESNGELTGFSPANPIPNHLLKEASDCAASP
ENSPPEESVPKYLKLFKPLLQSKVWKRQNEKAKSTASSTAPSSTPAKARAHSSPRNSSDG
GGRVGGFKIVTKHLGKSRSAPSNFHHCFDLRLMMLRT
Download sequence
Identical sequences A0A022PVQ6
mgv1a013544m|PACid:17691159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]