SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a017844m|PACid:17694442 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a017844m|PACid:17694442
Domain Number 1 Region: 432-563
Classification Level Classification E-value
Superfamily BRCA2 helical domain 4.45e-37
Family BRCA2 helical domain 0.00046
Further Details:      
 
Domain Number 2 Region: 564-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-34
Family Single strand DNA-binding domain, SSB 0.00025
Further Details:      
 
Domain Number 3 Region: 726-843
Classification Level Classification E-value
Superfamily BRCA2 tower domain 7.59e-21
Family BRCA2 tower domain 0.0023
Further Details:      
 
Domain Number 4 Region: 696-725,843-928
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-19
Family Single strand DNA-binding domain, SSB 0.013
Further Details:      
 
Domain Number 5 Region: 937-1087
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000805
Family Myf domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a017844m|PACid:17694442
Sequence length 1092
Sequence
MSSWQMFSDATNNFRWEIADQQLQEEEQQCDDLMENGEDNLGNPPMFRTGLGKSVVVKQS
SIAKARSVLGGIDDSLMKSAVNLKYGSQSGPEKVVNMSNSMFQTGLGRTVNISSAGLLRA
KTLLGLDENCDQESFYGSDQRHKQSTSTEFIARENPSCFETDLSNLSFSSSTKPLKSSNF
KSGSCRKKSTKLPDFTNADSKPPPVKFHTAGGRSISVSNDALLRARSLLGNPEFDFLDEA
STADPLFSVIDNGKASFLSSQRDEFNTPFSHQKTESSGSSLTNFTSPTRSISNQKQLYGK
SEKRGPGNNLIAQFDAEAAMSNLKRPFNGLTCDRKPPKRNSYSEKVDNSENTLQPKINPS
KRSNGALVDITNTTNIDHSESKEHLGEKRRLRRISSVSPFKKPRTSFVTPLNKNNSSVNV
LSRLAPKEPHCKQRVSMRYPLQVPRAYLKEYVLQPPSLKKKLENLPEHVRKMNPIAAESY
TFASEVPADCIGPEAFYCMLSQSGASVQHMTKEWVSNHYKWIVWKLASYERCYPVKFAGK
LLTVSNVLEELRYRYEREVNHGHRSSIKKILDGDAPPSSMMVLCISFVGKGCYPEFGNEP
VSLEEVGNDRASQVELTDGWYAVKARLDELLSQKLASGKLFLGQKLRIWGARFCGWNGPV
SPFEASQTVSLVLHTNGTYRCHWAERLGFCKRVGLPLAFRCIKGTGGAVPSTLVGVTRIY
PVLYRERLSAGSFVVRSEREEAKALQLYNQRRDIVAEGIISASQREVEFDVGYDHESEEG
ARLMKLLETAAEPEVLMAGMSSKQLTSFASYKAKLEAMRHTNMQKSIEDAVEAAGLSERD
VTPFLRVRVVGLTSNCHPRESCPRKGLITIWNPTQKQTLELCEGQAYAVGGLVPSSSDSG
ILYLQARGATNNWLPMSPLKMENFAPFFTPRSSTAVLSIGEVPLSSEFDIAAFVVYVGEV
YRQGNQQKQWVFVTDGSSSEFCSEESLDALLAINFCLPCIGLDSSAPVNSNIAGSVVGFC
NLTKRSKDHVNGIWVAEATENSDYFLSYDRAGRNHLKDVSASVLKWANTSSSIIENLKER
VLTIIRNSKDGC
Download sequence
Identical sequences A0A022RQD7
mgv1a017844m|PACid:17694442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]