SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a000012m|PACid:17688916 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000012m|PACid:17688916
Domain Number 1 Region: 2220-2511
Classification Level Classification E-value
Superfamily BEACH domain 1.31e-123
Family BEACH domain 0.0000000105
Further Details:      
 
Domain Number 2 Region: 2638-2703,2737-2851,2884-2931
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.32e-30
Family WD40-repeat 0.0094
Further Details:      
 
Domain Number 3 Region: 2101-2210
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-22
Family PreBEACH PH-like domain 0.0012
Further Details:      
 
Domain Number 4 Region: 470-612
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000226
Family SO2946-like 0.089
Further Details:      
 
Weak hits

Sequence:  mgv1a000012m|PACid:17688916
Domain Number - Region: 760-818,905-973,1086-1239
Classification Level Classification E-value
Superfamily ARM repeat 0.000168
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a000012m|PACid:17688916
Sequence length 2959
Sequence
MEEEETGDNNISGKNHEQQKESTGLDDNIAISKASNAEIPINYVDNVSAENVLRGVDSAS
PVLEDGLFEPVSLKDQDKNGKEINQSLSPEELRHSSIENEDAFEFSFASVDTSGFDSPPD
AEVHHNRYSSPGPERNSNYDLKESSSSASLDSAMHFYGDSGYSPADSPQKPKPKQVMPNV
SPELLHLVDSAIMGKAESLEKLKNVVSGAENFGGDGEAVAMSYLVVDSLLATMGGVESFE
EDEDNPPSVMLNSRAAIVAGELIPWLPDIGDFGGLMSPRTRMVRGLLAILRACTRNRAMC
SLAGLLRVLLRSAERIFVQDISSKEKIKWDGTPLCYCIQYLAGHSLTPGDLHCWLEVINR
TLPTAWSARLLNSLEKAMGGKEVRGPASTFEFDGESSGLLGPGESRWPFINGFAFATWIY
IESFADNISTATTAAAIAMAAAATSGKASPMSAAAAASALAGEGTAHMPRLFSFLSADNH
GMEAYFHAQFLVVECGSGKGKKASLHFTYAFKPQCWYFVGLEHTCKQGLLGKSESEMRLY
VDGSLYESRPFDFPRISKPLAFCCIGTNPPPTMAGLQRRRRQCPLFAEMGPVYIFKEPIG
PERMARLANRGGDVLPSFGSGAGSPWLATNEHIQKMARDSALLDTEIAGCLHLLYHPNLL
SGRYCPDASPSGAAGMLRRPAEVLGQVHVATRMRPTEALWALAHGGPLFLLPLVVSDVHE
NSLEPRRSHHSSSLATTALAAPIFRIISLAIRHPGNNEELCRRRGPEILSRILNYLLQTL
SSPDTSERDGDEELVAAIVSLCQSQKFNHTLKVQLFSTLLLDLKIWRLCSYGLQKKLLSS
LADMVFTESSVMRDANAIQMLLDGCRRCYWIVRESDSVNTFSTSKDGHLVGEVNALVDEL
LVVIELLVVAAPPSLAADDVRCLLGFMVDCPQSNQVARVLHLIYRLVVQPNKSRAQTFAE
AFISCGGIETLLVLLQRETKAGDCDVPEVLAEHDEALASINTDVDESEVASSKIGHSDGG
SSERRDLSLHENVRETEKFTGPIVSNIERMSSISENPFNRNLGGISYSISAENARNNVYN
IDKSDGIVVGIINLLGALVISGHLKFDSPPLLDVKNNILDMLEGGGTMFDDKVSLLLFGL
QKAFQAAPNRLMTSNVYTALLAASINVSSADDGLNFHDSGHRFEHFQILLVLLRSLPYAS
TTLQSRALQDLLILACSHPENRSSLTKMDEWPEWILEILISNYETTGTKNLNQSSLRDVE
DFIHNFLIIMLEHSLRQKDGWKDIEATIHCAEWLSMVGGSSTGELRIRREESLPIFKRRL
LGGLLDFAARELLAQTQVIAAAAAGVAAEGLAPKDAKIGAENAAQLSVALVENAIVILML
VEDHLRLQSKLYSASCLPTTTVSPLSNVLPARGHSTSTQDGETTSRNSSSSESGGLPLNV
LAAMADANGQISTAVMERLTAAAAAEPYESVSCAFVSYGSCVIDLAEGWKYRSRLWYGVG
LPLEASLFGGGGGGRESWKSALEKDADGNWIELPLVKKSVAMLQALLLDESGLGGGLGIG
GGSGTGMGGMSSLYQLLDSDQPFLCMLRMVLVSLREDDDGENHMLIRHASTEDGLVEDLR
RHTNRAASFDKNTRMTRKPRSALLWSVLSPILNMPIAETKRQRVLVASCVLYSEVWHAIG
KDRSPVRKQYLEAILPPFVAVLRRWRPLLAGIHELATADGVNPLVADDRALAADALPVEA
ALAMISPSWAASFASPPAALALAMIAAGAAGGETTAPPTASHLRRDSSLLQRKTTRLHTF
SSFQKPLESPNKSPAVPKDKAAAKAAALAAARDLERNAKIGSGRGLSAVAMATSAQRRSS
SDAERVKRWNASEAMGVAWMECLQSVDSKSVYAKDFNALSYKYIAVLVGSLALARNMQRS
EIDRRSQVDVIAHHRLYTGIREWRKLIHCLIEMKCLFGPLSEDLCNPKQVFWKLDFMESS
SRMRRIMRRNYQGSDHLGAAANYEDYMDQKQKGVSPSKASILAAEAISTELGNEEDEHDT
AYLDVSPSGEQPGDIQTIPFGPGEQPFTSTESTDPPVTNEQDSAPIPETVAPGYVPFEHN
ERIILELPSSMVRPLKVLRGTFQVTTRSINFIVDHTDNSAVGDMDRNGVNGVQEKDQCWL
MSSVHQVYSRRYLLRRSALELFMVDRSNYFFDFGNTEGRRNAYRAIVQARPPHLNNIYLA
TQRPEQLLKRTQLMERWARWEISNFEYLMQLNTLAGRSYNDITQYPVFPWILSDYSSQNL
DLSSPSSFRDLSKPIGALNAERLQKFQERYSSFDDPVIPKFHYGSHYSTAGTVLYYLTRV
EPFTTLSIQLQGGKFDHADRMFLDIAATWNGVLEDMSDVKELVPELFYLSEVLTNENSID
FGTTQLGAKLGSVRLPPWAENEVDFVHKHRMALESEHVSEHLHEWIDLIFGYKQRGKEAI
QANNVFFYITYEGTVDIDKISDPVQQRAAQDQISYFGQTPSQLLTTPHMKRMPLADVLHM
QTIFRNPREVRPYMVPYPERCNLPASAIHASSDSLIIVDVNAPAAHIAQHKWQPNTPDGQ
GAPFLFEHGKPDAGAAGGAFMRMFKGPTASGSEEWHFPQALAFPTSGIRSSAIVSITCNK
EIITGGHVDNSIKLISADGAKTLEVARGHFGPVTCLSISPDSNYLVTGSRDTTLIVWRIH
RSSISRSSEPSSNPGTPTSITGNNLASDRNSKSRRIEGPLHVLRGHLSEVTCCAVSSDLG
IVASCSNSSDVLIHSIRRGRIITRLSGVEAHSLCLSPDGIIMTWNKYLSTLTTFTLNGTL
IAKKQLPLSSSVSCIEVSADGCSALVGLNPSRENDRSSDLKFARHGNEDCQVDEANRLDL
PLPCICFFDLYTLKVLHTLKLAQGQDITTVALNKDSTNLLVSTANRQLIIFTDPSLSLKV
VDHMLKLGWEGDGLTPLIE
Download sequence
Identical sequences A0A022RMS2
mgv1a000012m|PACid:17688916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]