SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a000703m|PACid:17679422 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a000703m|PACid:17679422
Domain Number 1 Region: 66-572
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.57e-84
Family Acetyl-CoA synthetase-like 0.0000328
Further Details:      
 
Domain Number 2 Region: 731-1007
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.35e-27
Family Quinoprotein alcohol dehydrogenase-like 0.0053
Further Details:      
 
Domain Number 3 Region: 586-643
Classification Level Classification E-value
Superfamily ACP-like 0.00000391
Family Peptidyl carrier domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a000703m|PACid:17679422
Sequence length 1012
Sequence
MAAGETAERKPSACCISHAFYKAASKFPHKIAVIHASGFARITRDNTAANAPPHDDAIEL
ASVERASSSRPPVYDGDECFTFSDIISAVDNLSSRLRHILNGADDPYLIKTQPGIYMEPS
VEYIVAVLSVLRCGEAFMPLDPSWPKARILSLLSSSKANLVIGVESSNEEKLFHRLDTIN
WLVSEGNCPVVYVCMKDIIKEQSRSLVLEWPCENERLRSFCYLMYTSGSSGKPKGVCGTE
IGLINRFMWMQETYPLHEGDIVLFKTAISFIDHIQEFLGAVLSTCTLVIPPFSQLKENIF
YITDFLQGYMIKRLVAVPSLMRAILPSLQSRRFRTIQYSLKLLVLSGEVLHLSLCKTLLK
LLPQTSILNLYGSTEVTGDCTYFDCKRLPLILEKEELSSVPVGLPLSNCEVVLVGEDAPL
QGEIYVSGLCVAAGYFDYPYLIPLADRVQKYFKTGDFARKLSSGDLVILGRKDRTLKVNG
QRVALEEIETAFRDHPSVVDAAVLSREVDGEILLLEAHVVMEEKNEDDELLKSSLRNWLL
NMLPLGYDTDSHIVTDTLWTLSGKVDYMSLAASTTIFGSPAIYEVSFCKVFSDALMVEKV
SVDDDFFEMGGNSISAAYASFKLGIHMKLLYTFPTPLRLQTALLSSKSSVQIEAYSGVDS
NMDNYNPIKKLKVESKEQSPRDILWNPGAVVHTECTFSRCNRSTHGLQCQEKISSNTASS
KIRPRDGKGFMQVQWKVDMGSCVDASPLVVFKGSRVCVFIGSHSRKFVCIDGKSGLVQWE
TKLEGRVECSAAILDDFSQVIVGCYEGKIYFLNFSNGSACWSFQTNGEHNLIIVHVFAFM
DVLFSSFWYSSFAVICCLVDGSVVNLNTSGSVVWKVKTGGPIFAGPCASRALPSEVLVCS
RDGSIYSFETETGNLIWKHSIGNPITSSPYVDDNSPISDRLICVCDSSGSIYVLRVDLNA
IGDSEQNTENTVREFARLDLQGDIFSSPVMIGGRIFVGCRDNHVYSIALDLE
Download sequence
Identical sequences mgv1a000703m|PACid:17679422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]