SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a001352m|PACid:17675785 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a001352m|PACid:17675785
Domain Number 1 Region: 96-236
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-41
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 711-785
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000883
Family PB1 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a001352m|PACid:17675785
Sequence length 835
Sequence
MNSELWHACAGPLVSLPPVASLVVYFPQGHSEQVAASMQKQAECIPSYPNLPSKLICMLH
SVTLHADGETDEVYAQMTLQPVTKYDQEALLVSDIGLKHNRQPTEFFCKTLTVSDTSTHG
GFSVPRRAAEKIFPPLDFSMQPPAQEISARDLHDQIWTFRHIYRGQPKRYLLTTGWSVFV
SSKRLVAGDTVIFIRDEKSQLRLGVRRANTQQPALSSSVISSDSMHLGVLAAAAHAAANS
TPFTIFYNPRASPSEFVIPFAKYNKSMYAQVSSGMRFRMMFETEESGVRRYMGTVTSVCD
LDPVRWKNSQWRNLQVGWDESTAGDRPCRVSIWETEPVVTPFYICPPPFFRPKFTTDDVS
DMDNMFGLKDASSSIFPGLNLVQLMNMQQNLGAHDHSKLLDFQSPGLLPPNLRNHQNQQI
GQIDQESTRNNTQQTSAYPQLACNVQMPQNELSYNRSALPMNSTIRELSFKQFTESPSPS
GIFQNRSQGQQIIQFPELQSLSQRPIVGGPQASQLHRVSEQMQLLQKLHQQQLPSPSINP
VTDSQSKNDLQNQTGPYALLGNALIHPLPNLSHSKIDVRIKHELPKHKSADMDAASSANS
YHQQNSFPMNGFDGDVQSHGRNGFPFGATGIDGFAPDALLSRGGFDSAKDNNMQNIETDL
SSGINSQSFGVPIMSFKPGCSNDIAPLNETCVQNGGLWSNQTQQRMRTYTKVQKRGSVGR
TIDVTRYKGYEELRHDLARMFGIEGLLEDPQRNEWKLVYIDHENDILLVGDDPWEEFLSC
VQSIKILSSSEVSQMSLDGDLGQIPVQTQACSGTHSGNNAWKSHYDDNSASSFNR
Download sequence
Identical sequences A0A022QH07
mgv1a001352m|PACid:17675785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]