SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a001526m|PACid:17695315 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a001526m|PACid:17695315
Domain Number 1 Region: 115-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-44
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a001526m|PACid:17695315
Sequence length 803
Sequence
MKIPSNGFMATAGEGEKKLINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKH
TDGIPSYPNLPSKLICMLRNVTLHADGETDEVYAQMTLQPVSKYDQEALLVSDIGLKHNR
QPSEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQELTARDLHDQTWTFRH
IYRGQPKRHLLTTGWSIFVSNKRLIAGDAVLFIRDERSQLLLGIRRANRQQPALSSSVIS
SDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYTQVTAGMRFRMMF
ETEESGVRRYMGTVTGVSDLDTVRWKNSQWRNLQVGWDESTAGERPSRVSIWEIEPVIAP
FYMCPPPFFRPKFPKHSGFPDDGSDLENIFKRGMPWNITDDFGIKDASSSIFPGLSLVQW
MSMQQNQQQSALFPNMVSSTPPQQNNTITSTNDPSKLLNFQSNNGNQQSQQIVGQIQPSN
ITWAQQQQQILHSPTNTQHNLQQQQQQQQQQQQQQIMLPQSSNSLNSDHNSQQASMYSQV
LQQQQQQQILTGNAAQLQQTDPSANRATVPFTSLTQDMLYQQHIGQQPNLVQRPQQPQRP
PQIQHASPPSLSEQQLQLQLLQKLQQQHQQQQHQLISPQSNSLEARVNQNQQAQQQNSLP
PPQRQSNGSCSSGPTPPVVQSSSHFPVNQFPGPQKTPFLDRVRSIHTDGDAPSCSNSPSK
SNFQFLRNQTESASLLDNLIYPHASSNLVQESHHHSKMDKAAPDNLKFKGGGGAADHLDA
ASSGMQLRLCLRTVWMLRSRVFR
Download sequence
Identical sequences A0A022QLZ5
mgv1a001526m|PACid:17695315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]