SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a002183m|PACid:17681642 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a002183m|PACid:17681642
Domain Number 1 Region: 507-629
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.41e-18
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 
Weak hits

Sequence:  mgv1a002183m|PACid:17681642
Domain Number - Region: 225-331
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 0.00248
Family Proton glutamate symport protein 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a002183m|PACid:17681642
Sequence length 704
Sequence
MEGINRYSSPSVGDLTSYGAANRPVKIIQLQHPSPSAAPSSSSPSFWGKWSARMKRMTRA
EWIQLFLPCYRWISTYEWREYLQPDLMAGITVGVMLVPQSMSYAKLAGLHPIYGLYSGFV
PIFIYTIFGSSRQLAIGPVALTSLLVSNVLGNIVDSSEQLYTELAILLALMVGVFECIMG
LLRLGWLLRFISHSVISGFTTASAVVIALSQAKYFLGYEIERSSKIIPLAKSIIFGADKF
MWQPFVMGSIILAILLTMKHLGKTRKSLRFLRAAGPLTAVVLGTTFAKLYHPASISLVGE
IPQGLPKFSIPKEFGYVKSLIPTTVLITGVAILESVGIAKALAAKNGYELDSNQELFGLG
VANIVGSFFSIYPTTGSFSRSAVNHESGAKTGLSGLVMGIIMGCALQFMTPLFEYIPQCA
LAAIVISAVVGLVDYDEATFLWRVDKRDFLLWTITCVVTLFLGIEIGVLVGVGVSLAFVI
HESANPHIAILGRLPGTTVYRNLQQYPEAYTYNGLVIVRIDAPIYFANISYIKDRLREYE
LEPDGSIGRGPGVTRIHFVILEMAPTTYIDSSAVQALKDLHQEYKSRNIQIAISNPNRDV
LVTLTRSGVVDLIGKQWFFVRVHDAVQVCLQRVQSLNNSPKTSSTNSPRTPSSMMENKTS
IFQRLSKQRQEDLSLSQLESGNLEISTSIDETPHLEEPLLPKKH
Download sequence
Identical sequences A0A022R2W5
XP_012842504.1.32330 mgv1a002183m|PACid:17681642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]