SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a002381m|PACid:17695121 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a002381m|PACid:17695121
Domain Number 1 Region: 110-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.28e-29
Family B3 DNA binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  mgv1a002381m|PACid:17695121
Domain Number - Region: 564-644
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00981
Family PB1 domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a002381m|PACid:17695121
Sequence length 681
Sequence
MKEIVEKSLDSELWHACAGCMVKMPPVNSKVFYFPQGHAEHSLASVDFGALPMIPPMILC
RVSSVKYLADHETDEVYAKIGLIPVGNNERVSYDDEDGIFGRINKSESGEKAASFPKTLT
QSDANNGGGFSVPRYCAETIFPPLDYTADPPVQNVTVRDVHGETWKFRHIYRGTPRRHLL
TTGWSTFVNQKKLVAGDSIVFMRAVNGDLCVGIRRARRGGGVSGNEYSSSVWNYGGGGNL
GVVSGFLEDENNKLMHRSGGVGKSREKGRVSPESVVEAAFLAASCQPFEVVYCPRASAME
FCVKASSVNAAMRIHWCSGMKFKMPFETDDSSRVSWFMGTVASVQFVDPVRWPNSPWKLL
QVTWDEPDLLQNVKCVSPWLVELASNMPALHLSPFSPPRKKLCLPLHHPNLPLDGRFPLP
SFSGNPLGPSSSLRCLPDNNITLGIQGARHAQIGVPLTDLHFSNKQLQTGILPPPSGNLP
LLEYPRANVLDRNEDGNDNVSCLLSMGNSNKKKSDDETCGAKKTPLFVLFGQPIHTEKQM
SYDRPGDAFSRVAFGQNASGGTKSLSTDFLCKVFLESEEVGHSVDLSALGSYKELYKKLE
DMFRIDRSEIVGHLFYRDDASGAAKQVGEEPFSEFVKATKTLRILMKPGSDDTERKLVTG
LPTSELGRNSSNQTGALSIFA
Download sequence
Identical sequences A0A022RB61
XP_012838622.1.32330 XP_012838623.1.32330 XP_012838624.1.32330 XP_012838625.1.32330 mgv1a002381m|PACid:17695121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]