SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a002753m|PACid:17683049 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a002753m|PACid:17683049
Domain Number 1 Region: 116-233
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-29
Family B3 DNA binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  mgv1a002753m|PACid:17683049
Domain Number - Region: 557-629
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0102
Family PB1 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a002753m|PACid:17683049
Sequence length 641
Sequence
MITFMESKEKMKETEKCLDSQLWHACAGSMVQMPSVNSKVFYFPQGHSEHASGIVDLRTC
PKIPSYIPSRVTAVKFMADPETDEVFAKIHLVPITGNEVVFDDHDAAAVGGGSENQEKPT
SFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSSDPPVQTILAKDVHGETWKFRHIYRG
TPRRHLLTTGWSTFVNHKKLVAGDSIVFMRAENGDLCVGIRRAKRGIGGSEAATGWNPAG
GNPAVPYGGLSAFFREDEGKLSRNSNGDSISSGRVKPEAVIEAATLGASGRPFEVVYYPR
ASTPEFCVRASLVKAALQIRWCSGMRFKMPFETEDSSRISWFMGTISAVHVADPIRWPDS
PWRLLQVAWDEPDLLQNVKRVSPWLVELVSSMPPIHHHNLSPFSPPRKKMRLPFDGQIPL
PAFSGNPFGCLPNNNNNNTPAGMQGARHGLSLSDLFPAGFMPLNRVPLPSTTANNENVSC
QLTMGNSNRGSKVSDNCKTAPFVLFGRPILTEKQISLSGCSSDTRTGNSSSDGNEGKLGN
NSDEGFQSELDLETGHCKVFMESEDVGRTLDLSLLGSYEELYEKLGSMFGVEISEIMNRV
IYRDATGAVRQIGDESFSDFLKTARRLRIVADTNKCKSVDF
Download sequence
Identical sequences A0A022R6H1
XP_012840931.1.32330 mgv1a002753m|PACid:17683049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]