SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a003127m|PACid:17686590 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a003127m|PACid:17686590
Domain Number 1 Region: 66-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-43
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 483-561
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000163
Family PB1 domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a003127m|PACid:17686590
Sequence length 606
Sequence
MEQLEASTHQGLDQQLPSFSLPSKILCKVVHVQLRAESDTDEVYAQVTLIPEQDQSEITS
PDPPLPEPQRCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMTQQPPWQELVASD
LHGNEWHFRHIFRGQPRRHLLTTGWSVFVSAKKLVAGDAFIFLRGENGELRVGVRRLMRQ
LNNMPSSVISSHSMHLGVLATASHAISTRTLFSVFYKPRTSRSEFIVSLNKYLEAQNHKL
SVGMRFKMRFEGEEVPERRFSGTIVGVGNNSSSCWTDSEWRSLKVQWDEPSSILRPDRVS
PWEIEPLVAATPPNSQTQQRNKRARPPVLPSPMQDLSPLGMWKSPSESPSFRGLYQSPKL
SSNTRASPMSYTDNLMPVSSNSAYQPNQIETAAESFTPVSEKRQVNGCRLFGIELVDHST
GDDTSAACQPGAAIEDSRIPLDSDYEQQSEPSNRNPSDVPSASYDPDKFCLRSPHEPHNR
QIRSCTKVHMQGIAVGRAVDLTRFDCYEDLLKKFEEMFEIVGELSGPTKKWQVVYTDDED
DMMMVGDDPWHEFCTMVKKIYIYTAEEAKKLSPKIKLPISEVQSGKLNSDAAVITEEQSS
TVGSGY
Download sequence
Identical sequences A0A022R4X4
mgv1a003127m|PACid:17686590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]