SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a003347m|PACid:17691212 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a003347m|PACid:17691212
Domain Number 1 Region: 267-380
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.48e-18
Family Ankyrin repeat 0.00095
Further Details:      
 
Domain Number 2 Region: 61-193
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000178
Family BTB/POZ domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a003347m|PACid:17691212
Sequence length 591
Sequence
MENGADLSSSLSFASSSYLSNGSSGHEMPSTAGFEVGANLELLSLSRLSSSLEKLVIGGA
EYDYSDAEIEVEGIAVGVSRCILAARSHFFHEIFKNNNAESRSSTKEGKKPKYILSELVP
HGKIGYEAFTVVLNYLYTGKVKASPAEVATCVDESCAHDACGPAINYAVEMMYASATFQI
KELVMVVQRRLLNFVDKAFVEDVIPILIVASTCNLNELLSHCLQRIARSDLDNTIIEKEL
PYQTQNEVKSLRLKSNNQEEEHDSIQADPTNEKRIKRIHRALDSNDVELVKMLLEESGIS
LDSALALHYAAAYCNPKIVAEVLNLGFADVSLRDPRGYTVLHVAARRKDPSIVVGLLTKG
ASVSDRTRDGVTAVTICRRLTRPKDFNEASVHGKETNTDRLCIDVLEREIRRNPLAGNMS
VSSMMVADDLHMRLLLLENRVAMARTLFPLEARVAMQIAHAESTFEFAGLSASKGSYGNF
REVDLNEIPSEQVKKLHLRLQALQKTVETGRRFFPNCSEVLDLLLEDDTLGDLLLEKGSP
EEQRTKRMRYIELKEDVIKAFNKDIAEHNKLSGLSSSSSRSNSPRVKVRRR
Download sequence
Identical sequences A0A022RRW7
XP_012830877.1.32330 mgv1a003347m|PACid:17691212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]