SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a003409m|PACid:17674843 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a003409m|PACid:17674843
Domain Number 1 Region: 223-367
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.95e-17
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 49-185
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000178
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a003409m|PACid:17674843
Sequence length 587
Sequence
MDSRTAFCDSNDVSGGSSSTCCAATATDSSLSPSPVQLPADVAAIKRLSDTLESVFLSPS
DSDFFADARLVAASGKEIPVHRCILSARTPFFKNLFASRERNAKLKLKELMKEYDVGYDA
LVTVLAYLYSGKIRASPKDVCVCVDDECSHLACRPAVAFMVEVLYASFIFQISELVARFQ
NSLMGILDKTTTDDVLMVLSVANMCGTVCGSLLARAIEIVVKSDLDVITLEKSLPQHIIK
QINESRIALGLLSPENSTCPDKHVKRIHRALESDDVELVRMLLKEERTNLDDAYALHYAV
AYCDSKTTAELLDLAIADINQRNPRGYTVLHVAAMRKDPKIIVSLLTKGARPSDLTSDGR
KALQISKRLTRAIDYYGSTEEGKSTPKDRLCIEILEQAERRDPLPGEASMSLALAGDDLR
TKLLYLENRVALAKLLFPMEAKVAMDIAQVDGTSEFHLSGIHKNQAGSQRTEVDLNEAPF
KIKEEHLNRLRALSKTVELGKRFFPRCSAVLNKIMDRDDYPDIAQMGNGSPEECPLKRQR
RMEIEEVLSKAFTEDKEEIDRTINLSTSSSSSSVGIMRPNGMLPFKN
Download sequence
Identical sequences A0A022QKB4
mgv1a003409m|PACid:17674843 XP_012848196.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]