SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a003483m|PACid:17675617 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a003483m|PACid:17675617
Domain Number 1 Region: 47-188
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000267
Family BTB/POZ domain 0.024
Further Details:      
 
Domain Number 2 Region: 271-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000117
Family Ankyrin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a003483m|PACid:17675617
Sequence length 582
Sequence
MENSGEPSSSISFTSPSHISNESTVNKVHTSVGSEAVLDLETISLSKLSSSLGQLLCESG
SDFTDADIVVEETSVGVHRCILAARSKFFDELLRKDKGSVGKEGKPKYCMVDLLPYGKVG
YEAFVIFLNYLYTGKLRPSPLEVSTCVNCVCPHDSCRPAIDFVVELMYASTIFQVSELVS
LFQRRLLNLVGKAIVEDVVPIIKVAFDCQLSQLLNECVHRVARSDFEAISIEKELPPIVA
QDIASLCLKSQSEQENKTGPVSPLHEKRVKRIHKALDSEDVELVRLLLTESDITLDEAYA
LHYAVAYCDPKTVTEVLSLGLADVNLRNNRGYTVLHVAARRKEPSIIVSLLTKGACAADP
TFEGRNAVTICRSLTRPKDYQMQREKGQEANKDRICIDVLEREMRRNPISMDVSISSIAM
VDDLHMKSLYLEDRVAFARMFFPTEAKLAMEIAHAEATSSLAGLLSSSGNLMEVDLNESP
ITQNKRLLARIETLSRTVELGRRYFPNCSQVLDKFMEDDLPDAFYLEKGTLEEQRMKRVR
FMELKGEVHKAFNKDKAKLHRSGFSSSPSSFKDHVGHKIRKL
Download sequence
Identical sequences A0A022RUF5
mgv1a003483m|PACid:17675617 XP_012829766.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]