SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a004183m|PACid:17669914 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a004183m|PACid:17669914
Domain Number 1 Region: 226-328
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-24
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 422-521
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-24
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 3 Region: 4-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.61e-23
Family B3 DNA binding domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a004183m|PACid:17669914
Sequence length 540
Sequence
MWHMRRPHFLLGFDSSLSSERLNIPYNFVKHLEGKTPGTALLVGPSGNDWYVNLIHTDNG
LFLNDGWADFVRDHFLEHGDAMVFRYDGELHFTVQIFDQSMCEKEAAFTVESSQDLSKYD
VNVVRKRGRERSALLDSIIEGVPKRMRTQSGSFRNVHENNLTVVDQNHNWMQQVDCGSNL
KSNVTVAVPLTIVPHENTDPSIGNQTTKLDMLLLSASEAERMAGSFTSSYPNFTKVMKKF
NISGSYTLNLPYQFATEHLPKCKLKIVLRNLKGETWTVNSIPTTKVQTSHTFCGGWLAFV
RDNNIDIGDICIFELVRKVEFNVRILRVGKEGTDGHNRGTANGGRDNSCTTSKKLSRRKS
KKKSDNTSVKAPPLCTQSTNCIVESEIHKRFGSLDKQGSHAKGCMSMKSVPEEKMAAQYF
VSSFPHFVRVMKKFNISGSFTLKIPYQFSVEHLPASRTEILLRNLNGKCWTVNSIPTTKV
QALHTFCGGWMAFVRDNDIQMGDICIFELVGKCEMRVHICGIGKKGLNYQNGTTRNLPMP
Download sequence
Identical sequences A0A022S1G9
mgv1a004183m|PACid:17669914 XP_012845475.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]