SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a005357m|PACid:17671079 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a005357m|PACid:17671079
Domain Number 1 Region: 130-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.79e-22
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a005357m|PACid:17671079
Sequence length 487
Sequence
MKLKIVHQSQENHAAEEEQIKNETMEIDQIETHKIRVLVEDDENPSPINPPPISAYDPML
VSGKRKRKPKEMIDEAPSVFRRRRKFSSSSSSSKYKDATLDSGGTSMSMGGPHSKSPTMI
RAEEVQSSLGNDHPSFLKFLVRSHVGSCFWMGLPVPFCKLHLPFKDTIVTLENENGEEFP
IKYIAHKTGLSAGWRKFVGGNKLLEGDVLIFHLIETCRLKVYVIRANDLTEVDGALSLLI
LDSQTKQSDAEMAIDAQIKKQRRQKSLPLTIVQMNNEAQLETSGNESEEVASEVLEGSKS
SSRAPNFNDVSCFEEFHVIVNGISIDSEIPEHIRRKYYDLCSTKNVFLHDCLLPGLYVKL
AGGIIVETVNIADAIRGCKLTTSKEEFEVWEKSLRSFELLGLNVGFLRVHLSRLFDIAFD
SEGALETRRYWAARMDRSRAEDEIENLEAKISELKEFSAKCDRDIENLKTRAERYEVMFR
EEVSASW
Download sequence
Identical sequences A0A022RH64
mgv1a005357m|PACid:17671079 XP_012835160.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]