SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a006592m|PACid:17677405 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a006592m|PACid:17677405
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.14e-28
Family N-terminal domain of MutM-like DNA repair proteins 0.0015
Further Details:      
 
Domain Number 2 Region: 146-234
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.49e-24
Family Middle domain of MutM-like DNA repair proteins 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a006592m|PACid:17677405
Sequence length 438
Sequence
MPELPEVEAARRALEDHCVGKKIRRSTVADDSKVIDGVSPKDFEAALVGKTIVAAHRKGK
NMWLQLDSPPFPSFQFGMAGAVYIKGVAVTKYKRSAVKETDEWPSKYSKLFVELDDGLEF
SFTDKRRFAKVRLLDNPVSVPPISELGPDALKEPMTVDGLNSSLSKKKIGIKALLLDQSF
ISGIGNWMADEVLYQAKIHPQQAASSLSKENCATLLKCINEVTNFAVEVDADSLRFPVEW
LFHFRWGKKPGKVDGKVIEFINAGGRTTAYVPELQKLTGNQAVKEASNKTTADKSHSVDQ
SENEEDEPKKAKVVKGRKTSNRAATKPSTKSKSDANVEDSDNDDDSNGVDDVISSKRTRG
AKNPPAKSKNGEGQKSQTRRKVAPAKRKIEESDGDDLSNSSGSSDNDNDNGKRAKASVAA
SKKKVASSRNAKPKKKVK
Download sequence
Identical sequences A0A022PZB0
mgv1a006592m|PACid:17677405 XP_012856689.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]