SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a007664m|PACid:17681812 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a007664m|PACid:17681812
Domain Number 1 Region: 266-367
Classification Level Classification E-value
Superfamily TAZ domain 3.4e-22
Family TAZ domain 0.00049
Further Details:      
 
Domain Number 2 Region: 74-188
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000369
Family BTB/POZ domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a007664m|PACid:17681812
Sequence length 399
Sequence
MGSPGADISWPSSVIESFDRSFDINIEEGNSSDISYFLEDKMPSPNNHHNIPKPPPLPRK
KLNRGLPKHCFVPKETRDVWEKLFKEGYGADVHVITENGSIIPAHLSILSVASPVIGNLL
QQSKVKNGVRFIRILGVPYDAVCTFIRFLYSSCYEEEEMNKFVLHLLVLSHSYTVPSLKR
ICEYILEQGWLNNENVVDVLQLAKNCDTPRLALFCLRIIMNDLKSISKTEAWKFMKRDNP
SLEQELLESVVEADSRKQERMKKIEERKVYLQLHEAMEALLHICREGCRTIGPRDKVLKG
SSIPCGFPACKGLETLIRHFYVCKTKVPGGCVHCKRMWQLLELHSRMCNEPETCKVPLCR
HFKVKMEHLSKKEEVKWKLLVRKVVAVKNAQKLFSPRRL
Download sequence
Identical sequences A0A022R9H9
XP_012839051.1.32330 XP_012839052.1.32330 XP_012839053.1.32330 mgv1a007664m|PACid:17681812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]