SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a008185m|PACid:17691716 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a008185m|PACid:17691716
Domain Number 1 Region: 244-344
Classification Level Classification E-value
Superfamily TAZ domain 5.1e-23
Family TAZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 52-168
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000199
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a008185m|PACid:17691716
Sequence length 382
Sequence
MDRRNEESPSRMEKSLPHPPPMPPHFNTRFHHKGLIITGSKIRGHSFLPSIAVNSSWDRL
FDEGYRADVTILTDDGGVIYAHSSILGVVSPIFKAMLNKIKTRGQSNRRSISIRGVPSEA
VRVFIRFLYSSCYEEESMKEYALPLLVLSHAYVVPQLKRLCECWLEHKLMNTENAVDIFQ
LALLCDVPRLSLISHRFILSNFKSVSSSDGWKDMKQSHPVLEKELANSVRHEDFRKKEIT
RKMNERKVYMQLYEAMEALVHICRDGCRTIGPHDKVPPKDDNTPCPYSACKGLEALVRHF
AECKMRRPGGCVHCKRMWQILELHSRLCANSDDCRVPLCRKFRQRRRKQSKKEEMTWRIL
VKKIVRSKSISGGPYFSLESTT
Download sequence
Identical sequences A0A022RWR6
mgv1a008185m|PACid:17691716 XP_012853908.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]