SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a009293m|PACid:17674048 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a009293m|PACid:17674048
Domain Number 1 Region: 67-176
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.54e-31
Family B3 DNA binding domain 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a009293m|PACid:17674048
Sequence length 347
Sequence
MSGRSGFNYEERSSSSSSSGFPLNYCSYGGGGGGGGAPPEFNNYGNGGEEEYSGGNHTAV
AAMVEREHMFDKVVTPSDVGKLNRLVIPKQYAEKYFPLDSSNNEKGLLLNFEDRNGKQWR
FRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDTVTFQRGLGDFGKDRLFINWRRRPDAPPP
PVSSSSSIIFPHSHFSFHSAYSPSNYSNWNSSNPLFYQQSPNNYPGIVNGNPCPRPGSIM
YLQRPGSFSPGGGWAAAAQPHTEAQRGGMVFDSVPVVQVANNSNNNSNGSGAAKRMRLFG
VTMDCPISEATADSEIIIHPDFDSLNYSNNYHNNYKGKDSLSLDLDL
Download sequence
Identical sequences A0A022PZ15
mgv1a009293m|PACid:17674048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]