SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a011106m|PACid:17694599 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a011106m|PACid:17694599
Domain Number 1 Region: 134-234
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1e-22
Family B3 DNA binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a011106m|PACid:17694599
Sequence length 292
Sequence
MANESSATAYEEARKQRLLENQKRFEDLGLLKLSKNLSNLKKPEKSQNRHVRSKAADNFL
IEPRRSSRARNPVPSYRDDVDVGLGGLPSSRKRSKLNSSWATYLARPLEEVKTASYEERV
RAHKYAEKLQSNLQDGNPSFVKSMVRSHVYSCFWLGLPGKFCKDHLSKSTVDMVLENEEG
EEYDAKFISERTGLSGGWRAFALDHKLDDGDALLFELIEPTRFKVYIVRAFDAEKEHEKE
NEKEPVLEHGSDGEGTLNKETKNRKKKDNNLTKPKKEESSEISGTRRSSRNK
Download sequence
Identical sequences A0A022S123
mgv1a011106m|PACid:17694599 XP_012843083.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]