SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a013244m|PACid:17680573 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a013244m|PACid:17680573
Domain Number 1 Region: 64-184
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.52e-40
Family Deoxycytidylate deaminase-like 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a013244m|PACid:17680573
Sequence length 226
Sequence
MEAANVVDVKGGSVPLTSVFTADQEVVEAKDGIISVASTCSGHQEVVEAKDGTISVASAF
AGHQEAVQDRDHKFLTKAVEEAYKGVDCGDGGPFGAVVVCNNEVVVSCHNLVLKQTDPTA
HAEVTAIREACKKLNRIELSDCEIYASCEPCPMCFGAIHLSRIKRLVYGAKAEAAIAIGF
DDFIADALRGTGFYQKANLEIKQADGNGALLAEQVFEKTRAKFQLY
Download sequence
Identical sequences A0A022PZW0
mgv1a013244m|PACid:17680573 mgv1a013248m|PACid:17680572 XP_012857114.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]