SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a013350m|PACid:17669552 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a013350m|PACid:17669552
Domain Number 1 Region: 66-210
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.11e-34
Family Deoxycytidylate deaminase-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a013350m|PACid:17669552
Sequence length 223
Sequence
MNSREITLFTAATLFGAVASAISVGLFFNTRSSKSRRSSNGVVGKKLSPRQSPFDPAKRK
GYLSWDDYFMAIAFLSAERSKDPNRQVGACLVSEKGIILGIGYNGFPRGCSDDKLPWSKK
SKNENPLETKYPYVCHAEVNAILNTNHASAAGQRLYVTMFPCNECAKIIIQSGVSEVIYY
VEKRLDNSDTTYAASNKLLSMAGVKVRRLQPQMDQILIKFDEF
Download sequence
Identical sequences A0A022PPQ6
XP_012829241.1.32330 XP_012829242.1.32330 XP_012829243.1.32330 mgv1a013350m|PACid:17669552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]