SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a013643m|PACid:17694603 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a013643m|PACid:17694603
Domain Number 1 Region: 29-205
Classification Level Classification E-value
Superfamily MIR domain 1.07e-58
Family MIR domain 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a013643m|PACid:17694603
Sequence length 214
Sequence
MAVSFFALAIFMLLTLDSDFSSAPVSAASEGVQITYGSVIKLMHEKTKFRLHSHDVPYGS
GSGQQSVTGFPEVDDSNSYWIVRTTPKSSAKQGDTIKSGTVIRLQHMKTRKWLHSHLHAS
PISGNLEVSCYGGDGQSDTGDYWRLEIEGNGKTWRQDQRVRLHHVDTNGYLHSHDKKYTR
IAGGQQEVCGVAEKRADNVWLAAEGVYLPVAESK
Download sequence
Identical sequences A0A022QBH6
mgv1a013643m|PACid:17694603 XP_012852720.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]