SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a014607m|PACid:17695109 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a014607m|PACid:17695109
Domain Number 1 Region: 80-177
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-24
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a014607m|PACid:17695109
Sequence length 184
Sequence
MKKVKPRVPKQPLDLSAVRRSNRVADLPPRTYKENLSVVPMGRARSSGRRRDLSNRVYAS
DEDRAYAIERAEELESRLDKDNMPVFVKPMLQSHVTGGFWLGLPVHFCNKHLPKSDEMMD
LVDEEGEVFPTKYLALKRGLSGGWRGFAIDHELVDGDALVFQLTDRTTFKVYIIRVNDSG
ESSD
Download sequence
Identical sequences A0A022RCB4
XP_012836953.1.32330 mgv1a014607m|PACid:17695109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]