SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a014702m|PACid:17684518 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a014702m|PACid:17684518
Domain Number 1 Region: 76-162
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-19
Family B3 DNA binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a014702m|PACid:17684518
Sequence length 181
Sequence
MHMDEDASDEDDVEQLRTTSKTINAKSKSKSKSSTNSTRGNTSGNGNIPCERIFKKKDLP
DCYGADIFRSGLASVPKNPYFVSRSRVARRKNELYIPKDVIVDYGLKISGTMFLVDERGN
KWKSKMIKWKDGRLWCTKGWRNLCNVNGINLDDTCICEFVREEGCEEYSLLVTVVGGGLD
K
Download sequence
Identical sequences A0A022RB72
mgv1a014702m|PACid:17684518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]