SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a015154m|PACid:17693821 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a015154m|PACid:17693821
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.35e-41
Family Deoxycytidylate deaminase-like 0.0000968
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a015154m|PACid:17693821
Sequence length 166
Sequence
MEAANAVQDRDQKFLTKAVEEAYKGVDCGDGRPFGAVVVCNNEVVVSCHNLVLKQTDPTA
HAEVTAIREACKKLNRIELSDCEIYASCEPCPMCFGAIHLSRIKRLVYGAKAEAAIAIGF
DSFIADALRGTGFYQKANLEIKQADGNVALLAEQVFEKTRAKFQLY
Download sequence
Identical sequences A0A022Q4S8
mgv1a015154m|PACid:17693821 XP_012855134.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]