SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a019054m|PACid:17674647 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a019054m|PACid:17674647
Domain Number 1 Region: 73-189
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000314
Family B3 DNA binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a019054m|PACid:17674647
Sequence length 198
Sequence
TADDSKVEDKEDQEYSDKKAKKRKSSNNLKKKKEAIGNGPPTPPPLPEEFKKTIQEIGKG
RNISEEAEMKLVIQKGLFETDLAAGNNRLSIPFTRVHDHGFLTEEEARFLTTRDRNNKMK
FKDVTIIEPSLRREKVKLSRWDMRKGNGKNTCSNYVINGKWRHIVERNRLEPGDVVQLWS
FRINQELHFALVKLPGNK
Download sequence
Identical sequences A0A022QBJ6
mgv1a019054m|PACid:17674647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]