SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a019645m|PACid:17697291 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a019645m|PACid:17697291
Domain Number 1 Region: 66-563
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.28e-81
Family Acetyl-CoA synthetase-like 0.0000341
Further Details:      
 
Domain Number 2 Region: 699-980
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-33
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 
Domain Number 3 Region: 552-611
Classification Level Classification E-value
Superfamily ACP-like 0.00000018
Family Peptidyl carrier domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a019645m|PACid:17697291
Sequence length 1037
Sequence
MAAGETAERKPSACCISHAFYKAASKFPHKIAVIHASGFARITRDNTAANAPPHDDAIEL
ASVERASSSRPPVYDGDDCFTFSDIISAVDNLSSRLRHILNGADDPYPINAQPGIYMEPS
VEYIVAVLSVLRCGEAFMPLDPSWPKARILSLLSSSKANLVIGVESSNEEKLFHRLDTIG
WLVSEGNRPVLCVCMNDIIKEQSRPLVLEWPCENERLRSFCYLMYTSGSSGKPKGVCGTE
IAVLSTCTLVIPPFNQLKENIFYITEFLQGYLINRLVAVPSLIRAILPSLQSRRFRRIQY
SLKLLVLSGEVLHLSLCKTLLKLLPQTSVLNLYGSTEVTGDCTYFDCKRLPLILEKEELS
SVPVGLPLSNCEVVLVGEDAPLQGEIYVSGLCVAAGYFDYPYLIPLADRVQKYFKTGDFA
RKLSSGDFVIIGRKDRTLKVNGQRVALEEIETAFRDHPSVVDAAVLSREVDGEILLLEAH
VVMEEKNEDDELLESSLRNWLLNMLPQVMIPTRILLTRSLPLTSSGKVDYMSLAASTTSD
EQDRINVKEMNQDNLIQVFSDALMVEKVSVDDDFFEMGGNSISAAYATFKLGIHMKLLYT
FPTPRRLQTALLSSKFSVQIDAHSGVDSNMDNYNPIKKLKVESKEQSPRDILWNPGAVVH
TECTFSRCNRSTHGVQCEENYSSNAASSKIRPRDGKGFMQVQWKVDMESCVDASPLVVFK
GSRVCVFIGSHSRKFVCIDGKSGVVQWETKLEGRVECSAAILDDFSQVIVGCYKGKIYFL
NFSNGSVSWSFQTNGEVKSQPVIDKRRHLVWCGSYDHNLYAIDYRNYCCIYKLPCGGSIF
GSPAINEMQENLYVASTSGHITALEIKTMPFKKLWKQDIGAPVFGSLSINYPNGNVICCL
VDGSVVVLNPSGSVVWKVLVCSRDGSIYSFETETSNLIWKHSIGSPITSSPYVDDNSPIS
DRLICVCDSSGSIYVLRVDSNAIGDSEQNTENTVREFARLDLQGDIFSSPVMIGGRIFVG
CRDNHVYLNSRYRSTGN
Download sequence
Identical sequences mgv1a019645m|PACid:17697291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]