SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a020517m|PACid:17676873 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a020517m|PACid:17676873
Domain Number 1 Region: 138-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000322
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a020517m|PACid:17676873
Sequence length 265
Sequence
MARDTARFDALVKVARQRLQELIEAKKHARSKSCTSTWSPPRRPRTKRIIVEDKPAVLIE
TADDDWKVDQDEEEQEEDEEYSNNKAKRRKLSNNIPKKKKEPIGNGPHTPPPLPEEYKMV
IQEIGRGRNISEEMKLVIQKGLFETDLAKANNRLSIPFTQVLDHSFLTDEETHFLTTRDG
NNKMKFKEVTIIEPSLERDKVKLSRWDMNKANGKNTSSNYVINGAWRHVAERNNLKPGNV
VQLWSFRIDHELHLALVKIPNNSNN
Download sequence
Identical sequences A0A022PTP5
XP_012827393.1.32330 mgv1a020517m|PACid:17676873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]