SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a020932m|PACid:17689037 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a020932m|PACid:17689037
Domain Number 1 Region: 109-185
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000327
Family B3 DNA binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a020932m|PACid:17689037
Sequence length 564
Sequence
MINVMHSVVNQLEKSLNPQLWHACAGGMAQTPPLNSGVYYFPQGHAEHAAGNLDSGEFSK
IPPLVLCRVLSVKYLADAESDEVFAKIKLVPLGANDEFDSNFDKSGVNEVSISKSNSFAK
TLTQSDANNGGGFSVPRHIYRGTPRRHLLTTGWSNFVSRKRLVAGDSVVFLRAENGELCI
GVRRAKTGLGVGAEVAAYGWNSGGRDFLGVGERGESVIEAVDLASCGRPFEVVYYPRAST
PEFVVRASVVRDAMRVRWCGGMRFKMAFETEDSSRISWFMGTISSVRVDDPIRWPNSPWR
LLQVAWDEPDLLQNVKRVSPWLVELVSNIPAIHLSPLSVPRKRPRLPELSGYPVSMPTFF
SNNPLSPLCCFSDNNISYSGIQGARHARILLPSSNFHYNKPQPFDFKPLVDYTSPSQKTE
NFEESNEAKKSPLFLLFGQPILTEEQIIASNLSDENRENVGDVSNGSVSGVIQNFPLEAS
SDGEFSRFEEQKLELGVETTHCKVFTEPEDVGRTLDLSILTSYEELYGKSESVFCMERSE
TSNNVVCSDSSGTTKHTGDECRVD
Download sequence
Identical sequences A0A022RHG8
mgv1a020932m|PACid:17689037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]