SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a020933m|PACid:17677098 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a020933m|PACid:17677098
Domain Number 1 Region: 24-86
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.00000000688
Family Deoxycytidylate deaminase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) mgv1a020933m|PACid:17677098
Sequence length 108
Sequence
MEAIDVLLQQWQKIGVTTEEVALRFSTCILYVTCEPCIMCASALSIIGMVMHIYLHSVCK
FLFDTLTLSWHFMAPVSGIKEVYYGLLSLHTKSSGKLTRFDTKLIICN
Download sequence
Identical sequences A0A022RIL1
mgv1a020933m|PACid:17677098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]