SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a021021m|PACid:17685080 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a021021m|PACid:17685080
Domain Number 1 Region: 121-236
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-29
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a021021m|PACid:17685080
Sequence length 546
Sequence
MINVMHSANKPMNQVEKILDPQLWQACAGGMAQIPPPNSKVYYFPQGHSEHANRHVDFNG
FSRIPPIIPCRVSAIKYLADSDSDEVYAKIRLVPLSMSDYDANDDNNDDNENGFLGFDKC
DEKEKTTNSFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSAEPPVQTILVKDVHGEVW
KFRHIYRGTPRRHLLTTGWSNFVNRKKVVAGDSIVFLRAENGDLCVGIRRAKRGVNGGQE
VVCGWSSSNGASASSLYRGFSDFLSGNRNNVMCDNSKGIGNCELPGVKERGNVSGESVLE
AVNLAVNGRPFEVVYYPLASTPEFVVRVRAVRAAMRVRWCSGMRFKMAFETEDSSRISWF
MGTISSVQVDDPIRWPNSPWRLLQVAWDEPDLLQNVKRVSPWLVELVSNMPPGGNLPPFS
PPRKRPRFPLPSDFLLPTFFNNPLSPISPLCFLPENIPTGVQGARHARFESQPSDLVHFK
KQIQPFDFKLLDDDDDALSRTKPILSDGNQENTGNVSNGSGSGVVQNFPPEASEDECKKL
DLGLET
Download sequence
Identical sequences A0A022RHZ4
mgv1a021021m|PACid:17685080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]