SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a021365m|PACid:17683516 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a021365m|PACid:17683516
Domain Number 1 Region: 152-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000302
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a021365m|PACid:17683516
Sequence length 279
Sequence
YIDLRRENYEEDRSMARDTARFDALVKVARQRLQELIEAKKHARSKSSTSTWSPPQRPRT
KRIIIEDKPAVLIETADDDWKVDQDEEEQEEDEEYSDNKSKRRKLSDNIPKKKKEPIGNG
PHTPPPLPEEYKMVIQEIGRGRNITEEMKLVIQKGLFETDLAKANNRLSIPFTQVLDHSF
LTDEETHFLTTRDGNNKMKFKEVTIIEPSLERDKVKLSRWDMNKANGKNTSSNYVINGAW
RHVAERNNLKPGNVVQLWSFRIDHELYLALVKIPNNSNN
Download sequence
Identical sequences A0A022PTQ6
mgv1a021365m|PACid:17683516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]