SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a021929m|PACid:17690783 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a021929m|PACid:17690783
Domain Number 1 Region: 77-193
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000177
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a021929m|PACid:17690783
Sequence length 202
Sequence
TADDSKVEDEEEQEEDQEYSDKKAKKRKSSDNLKKKKEAIGNGPPTPPPLPEEFKKTIQE
IGKGKNLSEEAEMKLVIQKGLFETDLAPGNNRLSIPFTRVRDHGFLTEEEARFLTTRDRN
NKMKFKDVTIIEPSLRREKVKLSRWDMKKGNGKNTWSNYVINGKWRHIVERNRLEPGDVV
QLWSFRIDQELHFALVKLPGNN
Download sequence
Identical sequences A0A022QSQ2
mgv1a021929m|PACid:17690783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]