SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a023506m|PACid:17673103 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a023506m|PACid:17673103
Domain Number 1 Region: 163-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000155
Family B3 DNA binding domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a023506m|PACid:17673103
Sequence length 311
Sequence
EIRPEPLLPASGLSIPSFSDDFYRKTKAKKSISDQIQNISDNNIYCPVPLRCVLPTLNTI
FRPEHLGFSRNRPCNKEYSGEFSATNLHDISTTSTTPTTGGRGKKNKLAKKPDIEKKKAK
SSNDKKKKAKLSPNHDEGDNVIIPLEEIPGLLQKIESHDGSKPVFLYKKKLEVSDVRDRL
NRLFISGCKANLMGFLTEEERTAVDADDRKGLEFVGIDKNGKFYNLHLVRWSSVKITVIN
KEWMKIIRANDAHEGDSVELWGYRRNNNNEFCLVLNFRKSENRNNGDGSSTSGSGSGTTS
VGGMTSSSPSP
Download sequence
Identical sequences A0A022QDP3
mgv1a023506m|PACid:17673103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]