SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a023691m|PACid:17681555 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a023691m|PACid:17681555
Domain Number 1 Region: 118-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000608
Family B3 DNA binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a023691m|PACid:17681555
Sequence length 249
Sequence
RDENNRFKTLARLANQRLHELMEADEMKKKKNRNKRKFRSKPVFEIPDDFVDWEVEYEEQ
QEQEEEEEEYSDRKGSAAKRRKSSSNNNSPKKKKESSGEGLSSSQPPPRPLPEEFKEEKL
VIEKGLFKTDLAKGNNRLSIPFTQVLDHTFLTDEETHFLTTRDGNNKMNFKEVTIIEPSL
ELEKVKLCRWDMNKANGKNTSSNYVLNGAWSNVAQRNHLEPDDVVQLWSFRIDQELHLAL
VKIPHNENN
Download sequence
Identical sequences A0A022PY70
mgv1a023691m|PACid:17681555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]