SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a025067m|PACid:17674538 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a025067m|PACid:17674538
Domain Number 1 Region: 115-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000104
Family B3 DNA binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mgv1a025067m|PACid:17674538
Sequence length 246
Sequence
MEADELKKKKNRNKRKFRSKPVFEIPDDFVDWEVEYEEQQEQEQEQEQEEEYSDRKASSA
KRRKSSSNNNSPTKKKKESSGEGSSSSQPPPRPLPEEFKEVIRRLAQGGKRVSEEKLVIE
KGLFKTDLAKGNNRLSIPFTQVLDHTFLTDEETHFLTTRDGNNKMNFKEVTIIEPSLELE
KVKLCRWDMNKANGKNTSSNYVLNGAWSNVAQRNHLEPEDVVQLWSFRIDQELHLALVKI
PHNNNN
Download sequence
Identical sequences A0A022PS48
mgv1a025067m|PACid:17674538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]