SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a026717m|PACid:17679853 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a026717m|PACid:17679853
Domain Number 1 Region: 63-94
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.00000268
Family Deoxycytidylate deaminase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a026717m|PACid:17679853
Sequence length 96
Sequence
YLPHCRPFAVLSASSAHAAPFFLALLFYFSPPPASDSSEIGIQAIRHSYSEMASLIEETV
QETESVAFMNLALEQAKLALDSLEVPVGCVIIQDQK
Download sequence
Identical sequences mgv1a026717m|PACid:17679853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]