SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for mgv1a026842m|PACid:17686862 from Mimulus guttatus v140

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mgv1a026842m|PACid:17686862
Domain Number 1 Region: 224-323
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000883
Family B3 DNA binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) mgv1a026842m|PACid:17686862
Sequence length 344
Sequence
MKIVQEIDFWDDQKPKRLILFRSNLPFLEEIDFWVDEKTPTKNHRLEEEDDEILFLDQIN
NSKTRVCSSCSSSSWKRDRSSITTVDQETDQHDQMNKKRKISSFRLFGADIITGISDVIS
DDYDDDWERRRKAKGKEKVVEELELEKVDDDSRNIFNPILFEEDGCNNSQALVIYEPRAT
NKEIKKKSQPIPRRSKKKLSTKEQDPPAPLPPPMQRRIQDRGSDPVFLFQKDLTCSDVNP
GLNRIFINRSEKLVEALTEEERRMVNNEDYYSGLRVFTMDQHAEDRDYEMELTKWNVGSY
MIVLKKEWMKFVRANNLLEGDRVEGWGFRVQGVFYLGLNAIIKN
Download sequence
Identical sequences A0A022RQH4
mgv1a026842m|PACid:17686862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]