SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc03839 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc03839
Domain Number 1 Region: 272-328
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.14e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00025
Further Details:      
 
Domain Number 2 Region: 13-43
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000366
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc03839
Sequence length 328
Comment length:328 contig:MiV1ctg83 region:84369-86198 strand:-
Sequence
MNDLMATQQGFGVEEIYRGVISDVVSQVREAFLDEGIDIEDWETKIQASGAVDLDARPPP
PPAQPPPTKQSRHHTTQNTSAQRPSTSDQTPGTSQRPGSSEQVQGTSTAASQQQKTLAVS
AQQQQSLPQLPAPLQLLNLPTQMLNAAVQFPPGILPPGSQCAIIEGPNGPNFVLLNPQMQ
LSLDSQAQLILQQNAGNPSFRRPVQEIATKKESSNQHIPQLDGGGPGMTDSSSEEEQEDD
PLKRYAGLEDETAQQESPAEEEVPLNSDDDQSDDEDLDTLFDADNVVVCQFEKVHRARNK
WKFILKDGVMQIKGKDYCFHKSNGEAEW
Download sequence
Identical sequences gnl|MincDB|prot:Minc03839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]