SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc06015 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc06015
Domain Number 1 Region: 230-278
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 5.89e-17
Family Cyanase C-terminal domain 0.0007
Further Details:      
 
Domain Number 2 Region: 172-222
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000321
Family Cyanase N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc06015
Sequence length 278
Comment length:278 contig:MiV1ctg160 region:52762-56358 strand:+
Sequence
MTRTGVSNWTELELTAFVEEISSRQELIFRRHRPVNPEIDLDAIWASVANACADRGFERF
AGRTRKQLQCDLWGKKKKEVMERYENALAAGIDESRKWKDWERLIIEMCKNNGGEEETPN
RKRPIEEQFLALANYQSNNNNKNGSNLDEISQTSSNLGWPKHVKLEDLKLQKIIGNSKEW
HTAACLGKMQFNESEAEKMIEIFQLGPDAKQWLKSIPNRGNTNNCASTSNDPLLYRFQEV
FNIYGDALKELINEQFGDGIMSAVDFRIDLQKELCNEG
Download sequence
Identical sequences gnl|MincDB|prot:Minc06015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]