SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc07885a from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc07885a
Domain Number 1 Region: 271-327
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.14e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00025
Further Details:      
 
Domain Number 2 Region: 9-41
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000023
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc07885a
Sequence length 327
Comment length:327 contig:MiV1ctg245 region:42285-43762 strand:+
Sequence
MATQQGFGVEEIYRGVISDVVSQVREAFLDEGIDIEAWETKIQASGAVDLDARPPPPPAQ
PPPTKQSRHHTTQNTSAQRPSTSDQTPGTSQRPSSSEQVQGTSAAAAPQQQKTLAVSTQQ
QQQQNLPQLPAPLQLLNLPTQMLNAAVQFPPGILPPGSQCAIIEGPNGPNFVLLNPQMQL
SLDSQAQLILQQNAGNPSFRRPVQEIATKKEASNQHVPQLDGGGPGMTDSSSEEEQEDDP
LKRYAGLEDETAQQESPAEEEVPLNSDDDQSDDEDLDTLFDADNVVVCQFEKVHRARNKW
KFILKDGVMQIKGKDYCFHKSNGEAEW
Download sequence
Identical sequences gnl|MincDB|prot:Minc07885a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]