SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc10010 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc10010
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000706
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.001
Further Details:      
 
Domain Number 2 Region: 52-103
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.0000000000000732
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc10010
Sequence length 114
Comment length:114 contig:MiV1ctg366 region:12741-13536 strand:+
Sequence
MTYQMYRSTTIGVALQTSLDDLITEGLISQQLAGTVMTTFDKCINKALSERARNKVNFKA
EKLRAYRFCDNVWTFMMENVEFRDAQRPIEGSIDRVKFVACDANVQKKGPLEKP
Download sequence
Identical sequences gnl|MincDB|prot:Minc01753 gnl|MincDB|prot:Minc10010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]