SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc10206 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc10206
Domain Number 1 Region: 140-370
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 1.44e-79
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000479
Further Details:      
 
Domain Number 2 Region: 68-140,369-577
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 4.07e-62
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc10206
Sequence length 581
Comment length:581 contig:MiV1ctg380 region:40011-42450 strand:+
Sequence
MDFCPYWQDMGLARYGFGKIWGSQNNYYFLEGEPTNLMKGKFVRLALSVFPTMYNKKFKM
DKYQNVQQKVCLVVIDGWGLSDEQHGNAIAKAKTPIMDKLCSGNWQKLEAHGLHVGLPEG
LMGNSEVGHLNIGAGRVIYQDIVRINLAVQRNEFVTNPQIVASAERAKKGSGRLHLLGLV
SDGGVHSHIDHLFALIRAFKQLQVPKVFIHFFADGRDTSPTSGAGYLEQLLQFISSEKYG
ELVTIVGRYYAMDRDKRWERIKMAYEAIIGGIGQKATVDRAVDVVRERYAQSETDEFLKP
VVFSDDGQVKDDDTLIFFNYRADRMRQICECLGLERYKDLNSSVPHPKNIQISGMTQYNK
EFPFPSLFPPVTHTNVLAEWLASQGVTQFHCAETEKYPHVTFFFNGGREVQFQDEERCMV
PSPKEVATYDLKPEMNAAGVAEKMVEQIESGRHPFVMCNFAPPDMVGHTGKFEPAVKAYE
AIGKIFEACQSYNYVLMVTSDHGNAEKMIAPDGSEHTAHTCNLVPFTCSSKTFVFKSTPP
TGDDGKERARALRDVAPTVLQLMGLPVPPEMDGVPLLEQRG
Download sequence
Identical sequences gnl|MincDB|prot:Minc10206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]