SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc18470 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gnl|MincDB|prot:Minc18470
Domain Number - Region: 11-63
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0209
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc18470
Sequence length 342
Comment length:342 contig:MiV1ctg1985 region:2889-4540 strand:+
Sequence
MICSTVYRPNTRNDYDRVENSQKKITNENKKYYEQWLEPLDSMRERPEFDHFIYTRMMGG
GLGNQMYRFAGLYAMGKMLNRTPVYVHEESKMHEIDKELAYVFPNYHSKVYFLKKDFKDF
HQFHFAQHCCDYHDPKILLEQNKGRGLYLAGGPNFLDTRYIEHMRPQILKIFEFSKELVS
KVSAIKDKIISEDTSSHKICIHTRVGDFKGVGESKTVEVNKAHVRMLKILKRLLKDKTYS
LLLFGTDKDFLKTIKVDESISKVHYIINLNLTRGEELNFATQICDSFLVTAAMSTYATWM
GYLMPDDRPIFFIRRLMQNPTIDTLFMLPESWIPIDENWLKD
Download sequence
Identical sequences gnl|MincDB|prot:Minc18470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]