SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc04914a from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc04914a
Domain Number 1 Region: 292-376
Classification Level Classification E-value
Superfamily E set domains 0.00000049
Family E-set domains of sugar-utilizing enzymes 0.048
Further Details:      
 
Weak hits

Sequence:  gnl|MincDB|prot:Minc04914a
Domain Number - Region: 383-423
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.028
Family HLH, helix-loop-helix DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc04914a
Sequence length 500
Comment length:500 contig:MiV1ctg118 region:49563-54158 strand:+
Sequence
MVPIPRRRPPFLSMYNNHQGLFGFAPQHSLLQPLPPPSHLSQRGGGILESAGVATSSSNN
LLLRSTTGIKSEHFLKSEHSTTASQLFNCWPNVSPMLQNCVGQLAKAKFELPPPSNLRKS
NFFHFTITLRDHGDHPVEVEQATFAGFVEKGKEVPGENTRNGIHYKLVLLFINGIRTEQD
FYVRLVDSQTKQAIAYEGQDKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVMLSM
TPRVDTDVLAVSDNMFVHNNSKHGRRVKRGGSESGTVEVPSSSSINSTNNALPVIKHIFP
SEVCCQSGGSAILIGENFHEGMQVFFGNSLTWSELITPQAIKVNIPVRPNAGSVDVFLCS
PKGQPKMRSNSIRFSFSSSSEPSIDTAFQRLQKLLPKYPTDPEPLPKEFILHRAADFAEM
LYVNCTAFYPIEPERLAATADYRNYPSQRVLNLASNPAAYIPYTNGNVAANFSNILYSSA
NGFPPFSNTFIQTLQKPGSY
Download sequence
Identical sequences gnl|MincDB|prot:Minc04914a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]