SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc04914b from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc04914b
Domain Number 1 Region: 279-363
Classification Level Classification E-value
Superfamily E set domains 0.000000472
Family E-set domains of sugar-utilizing enzymes 0.048
Further Details:      
 
Weak hits

Sequence:  gnl|MincDB|prot:Minc04914b
Domain Number - Region: 370-410
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.028
Family HLH, helix-loop-helix DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc04914b
Sequence length 487
Comment length:487 contig:MiV1ctg118 region:49563-54158 strand:+
Sequence
MYNNHQGLFGFAPQHSLLQPLPPPSHLSQRGGGILESAGVATSSSNNLLLRSTTGIKSEH
FLKSEHSTTASQLFNCWPNVSPMLQNCVGQLAKAKFELPPPSNLRKSNFFHFTITLRDHG
DHPVEVEQATFAGFVEKGKEVPGENTRNGIHYKLVLLFINGIRTEQDFYVRLVDSQTKQA
IAYEGQDKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVMLSMTPRVDTDVLAVSD
NMFVHNNSKHGRRVKRGGSESGTVEVPSSSSINSTNNALPVIKHIFPSEVCCQSGGSAIL
IGENFHEGMQVFFGNSLTWSELITPQAIKVNIPVRPNAGSVDVFLCSPKGQPKMRSNSIR
FSFSSSSEPSIDTAFQRLQKLLPKYPTDPEPLPKEFILHRAADFAEMLYVNCTAFYPIEP
ERLAATADYRNYPSQRVLNLASNPAAYIPYTNGNVAANFSNILYSSANGFPPFSNTFIQT
LQKPGSY
Download sequence
Identical sequences gnl|MincDB|prot:Minc04914b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]