SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc06294a from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc06294a
Domain Number 1 Region: 21-187
Classification Level Classification E-value
Superfamily E set domains 0.0000000000014
Family Arrestin/Vps26-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc06294a
Sequence length 734
Comment length:734 contig:MiV1ctg171 region:86016-91884 strand:+
Sequence
MVVARSPSAAAASMADSLFERFEVEFDAGTHPVFHGGELITGSLKIQLKKEVTINAIRIQ
FRGRAVYLDPKHPTKEAAEKVYFDKNFILLERPPGHPEPGHFPWSANFLYSLPFECPLPK
GCETSYEGPHGFIRYYARAILETAEPDKAKYIVKQCFSIISSPELHQLVPPISDPISEKK
TVRFGSCCCRGKMTAEILLPKSSYAPGEDVIGNFTMDSSTAKNALEHIEVRLIDRLQRIT
SDLEPIKEATPTVTEPVNGVEGKTGKKLKNKQKQKNGTNDNSANKADDQQQKEETKKQKK
SNSIPTTKPSPSSTNSFERHRVVFGRRLVKEDFKGETTPERRNSGENKNVITKTNVYFLR
IPAIISTTQLNDQQQQQSASQFDELVDGVDAENGQFHRLLESPSTATLRARREPFLRVDY
ALQLHIPRPGGGMGIGFQPFAGGAQSVAESDESSYIPYKGPFTFAPLYPIYLEPPKNLIV
SEETILTPISEPAIKTTTNVKSQHPKQSINGGIKSEELQQQPFIVVTSTSTTKEENTKKT
ITTFPETTTTTTTITEERTTITKEEEENKIITEEIVSGKDNFPEVSELNKGGSEIKEKPL
EQIIIKEEKPETIIIEEQEQLPNGGTKTTKIEETILQQNGDESDEIVRKSVVETEAYEIN
NDDGSTVSVQKTTTTTTELTTTTPTVVINREHYNDINNDQQNEVDEQENKNTKNKENNSN
GILDNQQMDVSMSG
Download sequence
Identical sequences gnl|MincDB|prot:Minc06294a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]