SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc12725 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc12725
Domain Number 1 Region: 200-311
Classification Level Classification E-value
Superfamily E set domains 0.000000000329
Family Arrestin/Vps26-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc12725
Sequence length 767
Comment length:767 contig:MiV1ctg597 region:23573-30572 strand:+
Sequence
MQCLDKREIPPVHLEHFNVKLDEKDACFAPGDVIAGSVHIIASTIFNEKNKLINFKKCLH
SSTENDDSLHINKLKMTVSGSARLKEENNKQNLIKNLQLGEHQFLFMEADLLVNAVNNIN
PSSEVRAGEVKTLKFEIRLPQRGLVTSLESKSVSVLYTIQLELMYRNNKSDEEIKAKTIC
GFTLVDCFDLARMPKFYFLPHVQNIVKKFGLFSCTGGQIRLHFSINRVAFVGGENIVIEG
KIENRTDRRVDKVAARLQQLVEINMARDCKNSNLTDVNEIHEDSLALFVDPGSTLKFVRY
FALPPLPPSSYALDGSDPETCYASATTEGNKFVTNRKISIEIINKCKRRNSAQQNISNEG
NIENKERLINVTYQLCIFVTTDGVDALELNVPIIIGSLPQRKLRFIDAVPPLTDIQFGNQ
NTFKKAALEAASIFSANGEVKDFVEKPASMVLFMPNRKEVTVKLGQKFYGEDSKSDGYKY
FCSDSQLNFTNKYPFYVNLPTSSKQSRKASIIANSVCAENSLRERQSTIHEENEEINIGE
NINNETTNLNLTQNAVNQIDKNNNDNTANEIIENQHRIISIKTVQYNINPIQPSANSLKE
QIDLNDPQNSVTINGNTLYYKHPYTTNETCVKQTSTTPDKITDHLNIAYQGKLMYHNRSC
PNNAACGFSCGLPYHAAVGDAVWGLFHNGQYKQSCLPDKHFIRDEAACINKCVQVERGDK
KIIVPITDVTIEMKVNEVDLSYYAFYDKMGCSMKESCKATITYIECP
Download sequence
Identical sequences gnl|MincDB|prot:Minc12725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]