SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|MincDB|prot:Minc16017 from Meloidogyne incognita

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|MincDB|prot:Minc16017
Domain Number 1 Region: 81-145
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-17
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 5-53
Classification Level Classification E-value
Superfamily L27 domain 0.000000001
Family L27 domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|MincDB|prot:Minc16017
Sequence length 177
Comment length:177 contig:MiV1ctg1078 region:1365-2247 strand:+
Sequence
MEGLSLDRDIRRINELIDNLTKTCDFPNLLQLQRNLQSPFFNSIRNVYEYVYQQNITNFD
EEVASPEILASAAAKSTIAVFSAAEGAAHPRIIELPKTDQGLGFNVMGGKEQNSPIYVSH
VIPGGVADLHGGLRRGDQLISINGVMKLRDVLKNNVDGQSINTPPLLADLSTDYEII
Download sequence
Identical sequences gnl|MincDB|prot:Minc16017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]